PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s929681g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MYB
Protein Properties Length: 248aa    MW: 28518.9 Da    PI: 6.107
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s929681g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.95.5e-191663148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT++Ede+l++ ++q+G g+W++I++  g++R++k+c++rw +yl
  PDK_30s929681g001 16 KGPWTAQEDEILIEHINQHGEGRWNSISKLTGLRRSGKSCRLRWVNYL 63
                       79********************************************97 PP

2Myb_DNA-binding53.26.9e-1769113147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg+ T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
  PDK_30s929681g001  69 RGKITPHEENIILELHAMWGNR-WSTIARSLP-GRTDNEIKNYWRTH 113
                        8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1891163IPR017930Myb domain
SuperFamilySSF466892.38E-3014110IPR009057Homeodomain-like
SMARTSM007178.2E-171565IPR001005SANT/Myb domain
PfamPF002492.2E-171663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-231770IPR009057Homeodomain-like
CDDcd001675.56E-121863No hitNo description
PROSITE profilePS5129424.98464118IPR017930Myb domain
SMARTSM007177.6E-1668116IPR001005SANT/Myb domain
PfamPF002492.2E-1469113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2471117IPR009057Homeodomain-like
CDDcd001674.86E-1073114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MEGQFGWGTL VDGWRKGPWT AQEDEILIEH INQHGEGRWN SISKLTGLRR SGKSCRLRWV  60
NYLRPDLKRG KITPHEENII LELHAMWGNR WSTIARSLPG RTDNEIKNYW RTHFKKSKKP  120
SKNVERARAR FMRQQQEQHE LKGEQHQEEE EEQQQQGDMR GIMTQIEEAA LAQGMQEMEA  180
CMYPLTSMLQ WGGCAGGGGV SRSMSDGSSE EEAWGSLWNL DDILDVGEGA CRGGFALQDQ  240
HDQVLTFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261611727127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008810819.11e-161PREDICTED: transcription factor MYB57-like
TrEMBLM0RWQ31e-103M0RWQ3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P03450_0011e-102(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.11e-67myb domain protein 79